Protein Info for SM_b21526 in Sinorhizobium meliloti 1021

Annotation: taurine uptake ABC transporter substrate-binding protein precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF13379: NMT1_2" amino acids 28 to 245 (218 residues), 36.9 bits, see alignment E=5.4e-13 TIGR01729: taurine ABC transporter, periplasmic binding protein" amino acids 32 to 335 (304 residues), 538.8 bits, see alignment E=2e-166 PF04069: OpuAC" amino acids 32 to 240 (209 residues), 48.7 bits, see alignment E=1.2e-16 PF09084: NMT1" amino acids 57 to 250 (194 residues), 52.5 bits, see alignment E=9.6e-18

Best Hits

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 100% identity to smk:Sinme_4746)

Predicted SEED Role

"Taurine-binding periplasmic protein TauA" in subsystem Taurine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q926G5 at UniProt or InterPro

Protein Sequence (339 amino acids)

>SM_b21526 taurine uptake ABC transporter substrate-binding protein precursor (Sinorhizobium meliloti 1021)
MIHLRSFKHLSGAVAIAAGVLTSFAAQAETSVVVGYQQIVGPFISAIADGRFDAAAKEAG
YTIDWRQFSSGGDISTALASGNVPIGVIGSTGTTAAASRGVELELFWILDNIGKSEALVA
REGSGIEKPEDLKGKNVGVPFVSTSHFHLLVGLEQVWKTDPREVNILNMKPPQIVAAWQR
GDIDAAYVWPPALSELLKSGKVISDSEAIGAASVPTFDGLVADKEWAEENPKFMAAFTKV
LADAYADYKANGSGWKADSPQVQGMVKLIGGDAEGIVQALNLLSFPTADEQVSDKWLGGG
AVRALEASAKFLVAQKQIDTALDDYAPFVNSAYAKEAAK