Protein Info for SM_b21500 in Sinorhizobium meliloti 1021

Annotation: glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 transmembrane" amino acids 216 to 233 (18 residues), see Phobius details amino acids 245 to 263 (19 residues), see Phobius details amino acids 268 to 287 (20 residues), see Phobius details amino acids 293 to 313 (21 residues), see Phobius details PF13641: Glyco_tranf_2_3" amino acids 3 to 208 (206 residues), 51.8 bits, see alignment E=1.5e-17 PF00535: Glycos_transf_2" amino acids 4 to 159 (156 residues), 60.3 bits, see alignment E=3.6e-20 PF13632: Glyco_trans_2_3" amino acids 82 to 283 (202 residues), 41.7 bits, see alignment E=1.9e-14

Best Hits

KEGG orthology group: None (inferred from 99% identity to smk:Sinme_4404)

Predicted SEED Role

"STRUCTURAL ELEMENTS; Cell Exterior; surface polysaccharides/antigens"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92U13 at UniProt or InterPro

Protein Sequence (347 amino acids)

>SM_b21500 glycosyltransferase (Sinorhizobium meliloti 1021)
MTISIIIKTLNEEKRIAATVESALAALQDTGGEVIIADSGSCDRTVEIASQYPVIIAQIA
PPARPSCGIGPQLGFQHSRHDYVCLIDGDMLLDAAFLKDAVRFLADHPTMAGVTGHVEEM
HISNLEFARRVSRNAPENRTGPIDRMNGGGLYRRSAIEDVGYLSDRNLHGYEEFDLGIRL
RSAGWRLYRLDRRFVQHFGHTVNSYRLLVRRWKTKYLYGIGELLRASLGKPYFFQLLQEL
PELKLWGLVYLWWLACLGLILLLPDTLLALAAVCASFAVAVLAVSFRKGGLSMGLYTVVA
WFFHAAALPVGFLRSRRLPAEPIESTILGKPSLGESSLGEPALGKTA