Protein Info for SM_b21486 in Sinorhizobium meliloti 1021

Annotation: metabolite transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 transmembrane" amino acids 49 to 68 (20 residues), see Phobius details amino acids 75 to 99 (25 residues), see Phobius details amino acids 109 to 129 (21 residues), see Phobius details amino acids 135 to 163 (29 residues), see Phobius details amino acids 176 to 198 (23 residues), see Phobius details amino acids 210 to 229 (20 residues), see Phobius details amino acids 262 to 286 (25 residues), see Phobius details amino acids 298 to 320 (23 residues), see Phobius details amino acids 329 to 350 (22 residues), see Phobius details amino acids 356 to 377 (22 residues), see Phobius details amino acids 389 to 410 (22 residues), see Phobius details amino acids 417 to 437 (21 residues), see Phobius details PF00083: Sugar_tr" amino acids 37 to 231 (195 residues), 54.5 bits, see alignment E=9.7e-19 PF07690: MFS_1" amino acids 46 to 405 (360 residues), 49.6 bits, see alignment E=2.8e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SM_b21486)

Predicted SEED Role

"MFS permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92U28 at UniProt or InterPro

Protein Sequence (446 amino acids)

>SM_b21486 metabolite transport protein (Sinorhizobium meliloti 1021)
MSSAMQQSLGPSSSSMERDARRIHDDTPVSAGNIAIGVVIGRAAEFFDFFVYGIASVVVF
PQLFFPFAPDRLTATLYSFAIFSLAFVARPVGSLVFMAIDRTYGRGVKLTIALFLLGGST
ASIAFLPGYATLGAWSIVLLAVFRLGQGFALGGAWDGLASLLALNAPQHHRGWYAMIPQL
GAPLGFMLASALFAYFLVSISKADFLAWGWRYPFFVAFAINVVALFTRLRLVMTKEFGTL
LDLHELQAAPVTEVLRANGGNVLVGAFVPLASFALFHLVTVFPLSWVEIYTDHGASSFLM
VQFLGAVCGILAIIASGLIADRIGRRNHLGICAVLIAIFSFVAPMLLQAGATGRDVFVIV
GFTILGLSFGQAAGAVASRFGKAYRYTGAALTSDLSWLIGAGFAPLVALGLTSRFGLAFA
GYYLLSGALCTILALVFSKKLEIDNE