Protein Info for SM_b21484 in Sinorhizobium meliloti 1021

Annotation: RNA polymerase sigma-E factor (sigma-24) protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 19 to 166 (148 residues), 85 bits, see alignment E=2.2e-28 PF22029: PhyR_sigma2" amino acids 21 to 72 (52 residues), 45.1 bits, see alignment E=1.7e-15 PF04542: Sigma70_r2" amino acids 22 to 83 (62 residues), 60.9 bits, see alignment E=1.7e-20 PF08281: Sigma70_r4_2" amino acids 112 to 163 (52 residues), 54.1 bits, see alignment E=2e-18 PF04545: Sigma70_r4" amino acids 116 to 163 (48 residues), 34.1 bits, see alignment E=3e-12

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 99% identity to smk:Sinme_4422)

Predicted SEED Role

"DNA-directed RNA polymerase specialized sigma subunit, sigma24-like"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92U31 at UniProt or InterPro

Protein Sequence (173 amino acids)

>SM_b21484 RNA polymerase sigma-E factor (sigma-24) protein (Sinorhizobium meliloti 1021)
MPAIGGHASRQSPLLEEQVVDLIPALRAFARTFTSASFEADDLVQETLLRALRSIEQFEP
GTSLKSWLFTIMRNAFRTQYKIRTRESPGSTNCAELPIPTAPSQEWSVLNGELRSALGAL
SPEHREVLVLVAGFGMSYKEAADICDCAIGTIKSRLSRARDELTAQMHGNPLN