Protein Info for SM_b21459 in Sinorhizobium meliloti 1021

Annotation: sugar uptake ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 signal peptide" amino acids 14 to 15 (2 residues), see Phobius details amino acids 35 to 35 (1 residues), see Phobius details transmembrane" amino acids 16 to 34 (19 residues), see Phobius details amino acids 78 to 99 (22 residues), see Phobius details amino acids 109 to 128 (20 residues), see Phobius details amino acids 161 to 187 (27 residues), see Phobius details amino acids 208 to 228 (21 residues), see Phobius details amino acids 269 to 291 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 90 to 287 (198 residues), 50.7 bits, see alignment E=9.8e-18

Best Hits

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 100% identity to smk:Sinme_4445)

Predicted SEED Role

"Maltose/maltodextrin ABC transporter, permease protein MalF" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92U54 at UniProt or InterPro

Protein Sequence (297 amino acids)

>SM_b21459 sugar uptake ABC transporter permease (Sinorhizobium meliloti 1021)
MNAARRMERQQRRTAWIFLLPLLLTLMAVAIWPLARSIFFSFTDAYLDAPSDYGFVGIEN
FVEVAEDPVFWGAVRNTLVFTLVSVGLETLLGLAIALLLHRAFLGRGIVRAAILIPWAMP
MVVSARIWEWMLNDQFGLINKLLVALGLVEKGVAWTADPSLILGTVIFIDVWVTTPFMVL
LILAGLQLIPEEIYEAADVSGVPQWKRFWSITLPLATPAIGVAILFRTLDALRMFDLSYV
LAANNENTMTMSIYARDQLISFQDLGLGAAASTWVFMIIGLIAIVIVGLLRLDRATG