Protein Info for SM_b21441 in Sinorhizobium meliloti 1021

Annotation: inosine-5'-monophosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 146 PF00571: CBS" amino acids 3 to 53 (51 residues), 51.2 bits, see alignment E=6.6e-18 amino acids 67 to 120 (54 residues), 46.5 bits, see alignment E=1.9e-16

Best Hits

Swiss-Prot: 32% identical to YLBB_BACSU: Uncharacterized protein YlbB (ylbB) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_4462)

Predicted SEED Role

"Small Molecule Metabolism; Central intermediary metabolism; salvage of nucleosides and nucleotides"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92U69 at UniProt or InterPro

Protein Sequence (146 amino acids)

>SM_b21441 inosine-5'-monophosphate dehydrogenase (Sinorhizobium meliloti 1021)
MRVSEIMTRDVHLASPNDTITAVARQMAENDIGFMPVGDDDRLIGMITDRDIVVRGVADG
MDPQARVADIMTTDVKYCFDDDEVDDVARNMGDIQVRRLPVVNHDKQLVGIVSLADAARE
QPQMAGTGLKGVTEPGGSHNQSNRSG