Protein Info for SM_b21433 in Sinorhizobium meliloti 1021

Annotation: methyl-transferase, S-adenosyl-L-methionine (SAM)-MTase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 PF05175: MTS" amino acids 34 to 176 (143 residues), 30.3 bits, see alignment E=1.1e-10 PF01209: Ubie_methyltran" amino acids 34 to 167 (134 residues), 58.3 bits, see alignment E=2.6e-19 PF13489: Methyltransf_23" amino acids 39 to 173 (135 residues), 53.8 bits, see alignment E=7.1e-18 PF13847: Methyltransf_31" amino acids 57 to 160 (104 residues), 64.9 bits, see alignment E=2.3e-21 PF08241: Methyltransf_11" amino acids 61 to 156 (96 residues), 78.5 bits, see alignment E=1.7e-25 PF13649: Methyltransf_25" amino acids 61 to 152 (92 residues), 71.6 bits, see alignment E=2.6e-23 PF08242: Methyltransf_12" amino acids 61 to 154 (94 residues), 45.3 bits, see alignment E=4.3e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SM_b21433)

Predicted SEED Role

"3-demethylubiquinone-9 3-methyltransferase (EC 2.1.1.64)" in subsystem Ubiquinone Biosynthesis (EC 2.1.1.64)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.64

Use Curated BLAST to search for 2.1.1.64

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92U77 at UniProt or InterPro

Protein Sequence (269 amino acids)

>SM_b21433 methyl-transferase, S-adenosyl-L-methionine (SAM)-MTase (Sinorhizobium meliloti 1021)
MSDVATRPNYDLRDEIKAYWSERAATFDLSPGHEIFSEEERAAWHRLILRHLGEGAGRSA
LDLASGTGVVSHLLDDLGFRVAGMDWSEPMLERARQKAKSRGRDISFRMGDAENTMEPDD
HYDVVVNRHLVWTLVDPAAAFREWLRVLKPGGRVLIVDGDFVNATRLERFFSSLSVWGQR
VGLLRPDAPSQPREMLETHRSILARVHFSQGARAEAVVGLLRAAGFADITVDTDLGEIHR
MQAKNWNLFKGLARRSQHRFAIRASKPVA