Protein Info for SM_b21417 in Sinorhizobium meliloti 1021

Annotation: CDP-glucose 4,6-dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 TIGR02622: CDP-glucose 4,6-dehydratase" amino acids 9 to 353 (345 residues), 483.4 bits, see alignment E=2.2e-149 PF01370: Epimerase" amino acids 15 to 250 (236 residues), 107.8 bits, see alignment E=1.8e-34 PF16363: GDP_Man_Dehyd" amino acids 16 to 320 (305 residues), 99.6 bits, see alignment E=7.6e-32 PF04321: RmlD_sub_bind" amino acids 50 to 173 (124 residues), 36.2 bits, see alignment E=1.1e-12 PF02719: Polysacc_synt_2" amino acids 66 to 196 (131 residues), 39.2 bits, see alignment E=1.5e-13 PF01073: 3Beta_HSD" amino acids 67 to 188 (122 residues), 22.9 bits, see alignment E=1.2e-08 PF07993: NAD_binding_4" amino acids 85 to 196 (112 residues), 23.1 bits, see alignment E=1.1e-08

Best Hits

KEGG orthology group: K01709, CDP-glucose 4,6-dehydratase [EC: 4.2.1.45] (inferred from 100% identity to sme:SM_b21417)

Predicted SEED Role

"Similar to CDP-glucose 4,6-dehydratase (EC 4.2.1.45)" (EC 4.2.1.45)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.45

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92U92 at UniProt or InterPro

Protein Sequence (356 amino acids)

>SM_b21417 CDP-glucose 4,6-dehydratase (Sinorhizobium meliloti 1021)
MSRLPDPEFWAGKRVLLTGHTGFKGSWAGVWLKEMGAHVTGYALPPASRPSLHDLLHPNE
APGGQFGDIRDGEALATIARKSEPEIVLHMAAQPLVRESYAEPAETFDVNVMGTVRLLEA
ARATPSVKAVLVVTTDKVYRNDESGRHFRESDTLGGHDPYSGSKAACELAVATWRSAYLK
ERGIRVATARGGNVIGGGDFSDDRLVPDVVRAALSGTRLNIRSPLATRPWQHVLDCLNGY
FLFAEALFKGESDVDALNFGPSPSEQAIPVRDVANAVQAAMGLDPEWDDVSALEQPREMR
TLGLDPALAGETLAWRPRLAQSQAIEWTARWYDGWRRGEAARQLTLDQIEAFTKGL