Protein Info for SM_b21406 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 TIGR02772: Ku protein" amino acids 5 to 258 (254 residues), 283.6 bits, see alignment E=7.7e-89 PF02735: Ku" amino acids 15 to 195 (181 residues), 161.6 bits, see alignment E=1.1e-51

Best Hits

Swiss-Prot: 62% identical to KU_RHOSK: Non-homologous end joining protein Ku (ku) from Rhodobacter sphaeroides (strain KD131 / KCTC 12085)

KEGG orthology group: K10979, DNA end-binding protein Ku (inferred from 100% identity to smk:Sinme_4490)

Predicted SEED Role

"Ku domain protein" in subsystem DNA Repair Base Excision

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92UA3 at UniProt or InterPro

Protein Sequence (294 amino acids)

>SM_b21406 hypothetical protein (Sinorhizobium meliloti 1021)
MAVSARAQWKGYLRFGEVTAPVALYTATSTSDRIAFHTVNRETGNRVRREFIDSVSGKPV
EKEDQVKGYEIGDERYVVLEPEEVASAVPESDKTLRVQAFIPCDEVEKVYFDKPYYLTPD
KMGTDAFALLREGMRKKKVAAIAQTVLFRRMRTILLRPHDKGLIATTLNFDYEVRSAKEA
FKEIPDIKIEGEMLDLAKHIIGMKKGTFSAEEFDDRYEAALADLIKAKLEGKSLPKRAPP
KVSKANDLLEALRQSAGMKKPPAASKKRAGKESAAKTKAKTAAKSAPAQRRRAS