Protein Info for SM_b21373 in Sinorhizobium meliloti 1021

Updated annotation (from data): D-tagatose 6-phosphate 4-epimerase [EC:5.1.3.40]
Rationale: Specifically important for: D-Tagatose. This protein is >50% identical to Atu3167, which converts D-tagatose 6-phosphate to D-fructose 6-phosphate (see PMC4661409). This information is in the recent releases of KEGG and MetaCyc.
Original annotation: sugar kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 57% identical to TAGPE_AGRFC: D-tagatose 6-phosphate 4-epimerase (Atu3167) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K00917, tagatose 6-phosphate kinase [EC: 2.7.1.144] (inferred from 100% identity to smk:Sinme_4760)

MetaCyc: 57% identical to D-tagatose 6-phosphate 4-epimerase (Agrobacterium fabrum C58)
RXN-18477 [EC: 5.1.3.40]

Predicted SEED Role

"6-phosphofructokinase (EC 2.7.1.11), PF08013 family" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization (EC 2.7.1.11)

MetaCyc Pathways

superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (19/22 steps found)
glycolysis III (from glucose) (10/11 steps found)
superpathway of glycolysis and the Entner-Doudoroff pathway (14/17 steps found)
homolactic fermentation (10/12 steps found)
glycolysis II (from fructose 6-phosphate) (9/11 steps found)
glycolysis IV (8/10 steps found)
glycolysis I (from glucose 6-phosphate) (10/13 steps found)
formaldehyde assimilation II (assimilatory RuMP Cycle) (7/9 steps found)
galactitol degradation (4/5 steps found)
superpathway of anaerobic sucrose degradation (14/19 steps found)
superpathway of N-acetylneuraminate degradation (16/22 steps found)
D-altritol and galactitol degradation (3/4 steps found)
D-galactosamine and N-acetyl-D-galactosamine degradation (3/4 steps found)
superpathway of hexitol degradation (bacteria) (13/18 steps found)
N-acetyl-D-galactosamine degradation (3/5 steps found)
1,3-propanediol biosynthesis (engineered) (5/9 steps found)
lactose degradation I (2/5 steps found)
hexitol fermentation to lactate, formate, ethanol and acetate (12/19 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.11 or 2.7.1.144 or 5.1.3.40

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92UY3 at UniProt or InterPro

Protein Sequence (426 amino acids)

>SM_b21373 D-tagatose 6-phosphate 4-epimerase [EC:5.1.3.40] (Sinorhizobium meliloti 1021)
MQENHLIDIARWSERPGPRGIPSICSAHPLVIEAAMLRAHREKAPVLIEATCNQVNQDGG
YTGMTPEDFTRFVGAIADRIEFPREKILLGGDHLGPNPWKHLPADEAMAKAEAMITAYAK
AGFTKLHLDTSMGCAGEPTALPDATTAARAARLAAVAEDAVGGRGGVLPVYIIGTEVPIP
GGALEELDTLEVTAPEAAIETVRVHRAAFEEAGAAGAFSRVVGAVVQPGVEFGNENVIAY
DRARAEKLSATLGQLHGMVFEAHSTDYQTPDALRELVADGFAILKVGPGLTFALREALYG
LDQIAAFLFPAARERTLAEVTEAVMREEPANWAKYYHGSAEEQRLQRHFSYSDRIRYYWP
HPKAAAAVDELMSLLDGVAIPETLISQFLAGSYARVRNGEVAPQAKPLALAAVDAVLQDY
FAACRV