Protein Info for SM_b21367 in Sinorhizobium meliloti 1021

Annotation: cytochrome c class I protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details PF13442: Cytochrome_CBB3" amino acids 77 to 157 (81 residues), 42 bits, see alignment E=9.6e-15 PF00034: Cytochrom_C" amino acids 79 to 160 (82 residues), 24.3 bits, see alignment E=6.1e-09 amino acids 293 to 360 (68 residues), 26 bits, see alignment E=1.9e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SM_b21367)

Predicted SEED Role

"Probable cytochrome c-552" in subsystem Soluble cytochromes and functionally related electron carriers

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92UY9 at UniProt or InterPro

Protein Sequence (374 amino acids)

>SM_b21367 cytochrome c class I protein (Sinorhizobium meliloti 1021)
MDLRNLHWTAVAKIVGLGAVLLVAAGVVFVWSGVYNVAASKDHLRITTWILTLIRERSIA
NRSFTIEVPPLDDDGMIRLGASHFEGACVACHNRPGEEINPIVSGMLPPPPDLMDISKRR
PPEEIFWIVKHGLKYTGMPAWPNTRRDDEVWAVTAFLASLPATAGNYPELAGLTRSQASS
DERSVGGSALTACGRCHEREGTGTNGDRIPRLAGLPEAYLLRSLQEYAKGTRPSGAMEPV
ADLLSEDAMRELAAHYSALRPTAGNQSAPPDPEQLRRGEAIANRGIAHQGVPACLSCHSG
RQSQQFPVLAGQHAEYIQEQIRLWRRGGRIGTPYGRIMTAVAGALDEAQIEDVAAYLGSL
PPGSATAPMTEVNR