Protein Info for SM_b21364 in Sinorhizobium meliloti 1021

Annotation: membrane-anchored oxidoreductase, L-sorbosone dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 517 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF23500: DUF7133" amino acids 121 to 433 (313 residues), 33.4 bits, see alignment E=4.9e-12 PF22807: TrAA12" amino acids 167 to 293 (127 residues), 48 bits, see alignment E=1.1e-16 amino acids 336 to 442 (107 residues), 49.9 bits, see alignment E=3e-17 PF07995: GSDH" amino acids 193 to 424 (232 residues), 48.1 bits, see alignment E=1.6e-16

Best Hits

Swiss-Prot: 51% identical to SNDH_GLULI: L-sorbosone dehydrogenase from Gluconacetobacter liquefaciens

KEGG orthology group: None (inferred from 100% identity to sme:SM_b21364)

Predicted SEED Role

"L-sorbosone dehydrogenase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92UZ3 at UniProt or InterPro

Protein Sequence (517 amino acids)

>SM_b21364 membrane-anchored oxidoreductase, L-sorbosone dehydrogenase (Sinorhizobium meliloti 1021)
MNSSAFLGARFFIGTGLLLLALAGCSDDGADFDVSQQIGPDPVLPEPTSELLPDMKVAEV
VGWQDGKTPSVPDNLVIAAYAKDLANPRTVHTLPNGDVLVVQSREPSGKPIERPKDMIRG
WVMSMAHGGGAGPEKESNLITLLRDTDRDGTVDERHDLLTGLHSPFGVAWHDGTLYVAAA
DAILAYPYQLGQAEITGEPRVLTPLPGGPINHHWTKDLALSPDGRYLYASVGSNSNVAER
GLEAEKGRAAIWQVDRETGAARVFASGLRNPNGLIFHPETGVLWTVVNERDELGPNLVPD
YMTSVQEGAFYGWPWSYFGAHVDERVHPPRPDMVEKAIPPDYALSSHVAALGLVFSNGSA
LPEPFANGAFIGEHGSWNRSSFNGYKVVYVPFENGRPAGKAQDIVTGFIEGDQARGRPVG
VAIDGTGALLVADDAGNTVWRVAGADGRVTPGPVGTDGQRDSPVTSEASPPAGETGGTAG
GAAPPAAGTTPPEPPQTDVAPATLPRATEQGSPEQQQ