Protein Info for SM_b21363 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 transmembrane" amino acids 87 to 112 (26 residues), see Phobius details amino acids 155 to 178 (24 residues), see Phobius details amino acids 198 to 226 (29 residues), see Phobius details amino acids 239 to 258 (20 residues), see Phobius details amino acids 270 to 292 (23 residues), see Phobius details amino acids 304 to 326 (23 residues), see Phobius details TIGR00765: YihY family inner membrane protein" amino acids 74 to 333 (260 residues), 118.5 bits, see alignment E=2.3e-38 PF03631: Virul_fac_BrkB" amino acids 83 to 335 (253 residues), 226.5 bits, see alignment E=2.3e-71

Best Hits

KEGG orthology group: K07058, membrane protein (inferred from 100% identity to sme:SM_b21363)

Predicted SEED Role

"Inner membrane protein YihY, formerly thought to be RNase BN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92UZ4 at UniProt or InterPro

Protein Sequence (364 amino acids)

>SM_b21363 hypothetical protein (Sinorhizobium meliloti 1021)
MQGTSQRLACSNAIRDRPPVRPIRGTANFRTREDNQMKSGDAKRGTDEQAQEAGRGRAAD
SPGEIPARGLRDVFWRVVSQISEDRISLIAAGVTFYVLLSVFPALASLVSIYGLVSDPAT
IAEQATLLAAVLPAQSLQMMTDQLETLSSQKTSSLSFGFIAGLLFALWSARNGVGALFEA
MNIAYDETEKRSFIRLTLLSIGFTLAGLILTAVLIAAIAVLPAVLAFLHLELEGLLRFVR
WPVMLLLIAAGITLIYRYGPSREPAKLRWLTWGAALSTICWLVASLAFSYYIDNFANYNA
TYGALGALIGFMLWIWISTMIVIIGAELNAELEHQTARDSTTGRPKELGKRDAYVADTVG
DTED