Protein Info for SM_b21347 in Sinorhizobium meliloti 1021

Annotation: pectin degradation protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 112 PF00190: Cupin_1" amino acids 30 to 94 (65 residues), 22.7 bits, see alignment E=9.6e-09 PF07883: Cupin_2" amino acids 38 to 95 (58 residues), 53.6 bits, see alignment E=2.3e-18 PF02311: AraC_binding" amino acids 49 to 93 (45 residues), 24.4 bits, see alignment E=3.1e-09

Best Hits

Swiss-Prot: 46% identical to KDGF_DICD3: Pectin degradation protein KdgF (kdgF) from Dickeya dadantii (strain 3937)

KEGG orthology group: None (inferred from 100% identity to sme:SM_b21347)

MetaCyc: 42% identical to unsaturated pyranuronate lyase monomer (Yersinia enterocolitica)
RXN-12877 [EC: 4.2.99.25]; 4.2.99.25 [EC: 4.2.99.25]

Predicted SEED Role

"Pectin degradation protein"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.99.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92V11 at UniProt or InterPro

Protein Sequence (112 amino acids)

>SM_b21347 pectin degradation protein (Sinorhizobium meliloti 1021)
MMDTKLFARGDEGEWVDLGQGNRRRVILHTDELMLVEFAFEKGGIGALHSHPHVQGSYIA
EGKFEVTVGERTQVLSTGDSFIAPSGVVHGVKALEAGRLIDSFTPHRADFLK