Protein Info for SM_b21283 in Sinorhizobium meliloti 1021

Annotation: allantoicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 TIGR02961: allantoicase" amino acids 15 to 333 (319 residues), 453.4 bits, see alignment E=1.6e-140 PF03561: Allantoicase" amino acids 24 to 169 (146 residues), 170.5 bits, see alignment E=1.1e-54 amino acids 189 to 334 (146 residues), 155.4 bits, see alignment E=5.1e-50

Best Hits

Swiss-Prot: 100% identical to ALLC_RHIME: Probable allantoicase (alc) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01477, allantoicase [EC: 3.5.3.4] (inferred from 100% identity to sme:SM_b21283)

Predicted SEED Role

"Allantoicase (EC 3.5.3.4)" in subsystem Allantoin Utilization (EC 3.5.3.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.3.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92VC1 at UniProt or InterPro

Protein Sequence (340 amino acids)

>SM_b21283 allantoicase (Sinorhizobium meliloti 1021)
MTRAGEVLPGFAGGTINLASAGLGARALFATDEFFGPLERMLKDEPAAFHPGLYDDHGKW
MDGWETRRRRGAGHDYAVIALAAKGRIAGFDVDTSHFTGNYPSACSIEACHSAEDPDEAT
EWVQLLPVTGLGPNAHHFFAAHSDAVYSHIRLRIHPDGGIARLRVYGTPALDLKAMANET
IDLASCLLGGRIVAFSNGHYGHERLIAPGRGANMGDGWETRRRREPGYDWIIVKLAARGH
VERILVDTAHFKGNYPDACSLQAADLGGMTAECDMLVASSAMFWNELLPHRKLSADSVHE
YGSDMLRHADPVTHVRLNIYPDGGVSRLRIYGRVADPRSR