Protein Info for SM_b21274 in Sinorhizobium meliloti 1021

Annotation: spermidine/putrescine ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 transmembrane" amino acids 32 to 56 (25 residues), see Phobius details amino acids 88 to 109 (22 residues), see Phobius details amino acids 120 to 142 (23 residues), see Phobius details amino acids 166 to 189 (24 residues), see Phobius details amino acids 225 to 248 (24 residues), see Phobius details amino acids 268 to 289 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 100 to 293 (194 residues), 36.8 bits, see alignment E=1.7e-13

Best Hits

KEGG orthology group: K02054, putative spermidine/putrescine transport system permease protein (inferred from 100% identity to sme:SM_b21274)

Predicted SEED Role

"Spermidine Putrescine ABC transporter permease component PotB (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92VD0 at UniProt or InterPro

Protein Sequence (299 amino acids)

>SM_b21274 spermidine/putrescine ABC transporter permease (Sinorhizobium meliloti 1021)
MRDARSCRRRATYSTAALPRKGLEMFHNRAEALALALPAAVFAAVVFLAPVVILLAEGFR
NADGWSVSAYSGFLSDPLNRTVFLRTLRLGAAVTVVAAVIGYAAAFAIVNLPPKGKGRMI
GLVVLPLMISPVARTYAWIVILGRTGIVNQALTSVGLTDEPVRFLFTETAVFVGLLQLFL
PLMILALISALENMPKDAIPAARVLGANWFQVFWKVILPLTREGLVIGGTLVFTGSLTAY
ITPAILGGSKVLMLETLLYQRVTVANDFVSASVIAFILIVMSFAANLLLKRLATARSKR