Protein Info for SM_b21250 in Sinorhizobium meliloti 1021

Annotation: glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 transmembrane" amino acids 146 to 157 (12 residues), see Phobius details PF13439: Glyco_transf_4" amino acids 61 to 222 (162 residues), 52.4 bits, see alignment E=2e-17 PF13579: Glyco_trans_4_4" amino acids 61 to 208 (148 residues), 63.3 bits, see alignment E=1e-20 PF00534: Glycos_transf_1" amino acids 225 to 385 (161 residues), 153.8 bits, see alignment E=1e-48 PF20706: GT4-conflict" amino acids 230 to 334 (105 residues), 32.4 bits, see alignment E=1.5e-11 PF13692: Glyco_trans_1_4" amino acids 233 to 373 (141 residues), 123.6 bits, see alignment E=2.3e-39 PF13524: Glyco_trans_1_2" amino acids 313 to 390 (78 residues), 31.5 bits, see alignment E=5e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SM_b21250)

Predicted SEED Role

"STRUCTURAL ELEMENTS; Cell Exterior; surface polysaccharides/antigens"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92VF2 at UniProt or InterPro

Protein Sequence (427 amino acids)

>SM_b21250 glycosyltransferase (Sinorhizobium meliloti 1021)
MSLGRRETVAAAAATTPVRDARRASGEGSLEMNDSSNSPAYEASNISGARVTIVLPGLGA
GGTEHVVNLVANHWVRRGCKVTIITLEPPDAKPYYALDPKISIERLGLPPQRAGKIEAGL
LVLKRIYRLRSAIRRSQPDFVLSFLTRTNVLTLLATIGLQAPVIVSERNNPALQPFGPVW
KWVQRRLYPRAFGLVTMTKGALDYFPEKMRSRGWVIANAVDLPGEWQKRRGNNILAAVGR
LTRQKGFDLLIEAFARIATRHPEWKLVIWGEGDDRKSLEALRDALDLRDRVELPGVTQRP
GLWVETADVFVLSSRYEGWGIVLLEAMAAGLPVVSFACEWGPSDMVKHGEDGILVPSNNV
DALAEALSRMLGDGELRSRLAANAEASAKRYLPERILSQWDAVASSALKHSAREHARAVS
AAEPGSA