Protein Info for SM_b21245 in Sinorhizobium meliloti 1021

Annotation: OMA family outer membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 signal peptide" amino acids 1 to 41 (41 residues), see Phobius details PF02563: Poly_export" amino acids 38 to 114 (77 residues), 48.5 bits, see alignment E=1.7e-16 PF10531: SLBB" amino acids 120 to 155 (36 residues), 34.2 bits, see alignment 3.8e-12 PF25994: HH_AprE" amino acids 168 to 352 (185 residues), 46.4 bits, see alignment E=1e-15

Best Hits

KEGG orthology group: K01991, polysaccharide export outer membrane protein (inferred from 100% identity to sme:SM_b21245)

Predicted SEED Role

"STRUCTURAL ELEMENTS; Cell Exterior; surface polysaccharides/antigens"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q926B5 at UniProt or InterPro

Protein Sequence (416 amino acids)

>SM_b21245 OMA family outer membrane protein (Sinorhizobium meliloti 1021)
MGISPAVYRTILPRWKLGAFLLMVLWALAFPMITSMPAQAGDYRLNSGDVLTFDFLDDAE
LPVTATVSGAGVAQFPLIGGVEVIGLTVPEALAKLRSEYRRRDVLVDPKISLDISTFRPI
FVLGEVKTPGSFPFYSGLTVEQAIGLAGGMQVAAASASDRIVARARLRAEAEAANAEIVH
EAIYAARLVAQLKSSDKIDLADVPEVARDYVTGVPLDGVIELEEKILKADLAANKSQAQI
LSEGITQSEGGIDILNQLILQQKDVVQNSKEDVERIATLRKRGLNTESDLSRAENSASAE
QAQLLETFATLARSRQELSGLKLQLAKLAADREKDILTQLQAREIAIQKLISGKHSAEEQ
ILLMAAVAEDETKKNQISYTYEIRRNPMGGTPTSIKASTLTELVPGDVLMVSIAGM