Protein Info for SM_b21235 in Sinorhizobium meliloti 1021

Annotation: formyltransferase, methionyl-tRNA(fMet) N-formyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 PF00551: Formyl_trans_N" amino acids 14 to 176 (163 residues), 74.9 bits, see alignment E=6.9e-25 PF02911: Formyl_trans_C" amino acids 203 to 277 (75 residues), 60.6 bits, see alignment E=1.5e-20

Best Hits

Swiss-Prot: 32% identical to FMT_MARHV: Methionyl-tRNA formyltransferase (fmt) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)

KEGG orthology group: None (inferred from 100% identity to sme:SM_b21235)

Predicted SEED Role

"Methionyl-tRNA formyltransferase (EC 2.1.2.9)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase or Folate Biosynthesis (EC 2.1.2.9)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.2.9

Use Curated BLAST to search for 2.1.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92VG6 at UniProt or InterPro

Protein Sequence (312 amino acids)

>SM_b21235 formyltransferase, methionyl-tRNA(fMet) N-formyltransferase (Sinorhizobium meliloti 1021)
MRIVFVGAVESSKIALDALIRAKRTPVLVITLPPEAAGRHSDFVGLGEIGRAAGSAIHHT
TDINSQATLEAVAAATPDLSLVIGWSQVCRQAFREIARAGTVGFHPAALPRLRGRGVIPW
TILRGEERTGSTLFWLDDGIDSGPILLQRQFPVAPDETARSLYTKHTENLAEMVVEAAAQ
VEAGSAARMEQNEAEASYCAKRTAEDGRIDWHDPAASILRLIRAAGDPYPGAFTFYKGQK
IRIDAATPVENSRQYIGLKGQIQAHTERGFIVLCGDGECIEAHAWAWASDRRPPNHGKLG
GSDLVQASAQNT