Protein Info for SM_b21220 in Sinorhizobium meliloti 1021

Updated annotation (from data): ABC transporter for D-Glucosamine, permease component 2
Rationale: Specific phenotypes on D-Glucosamine Hydrochloride.
Original annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 72 to 93 (22 residues), see Phobius details amino acids 105 to 125 (21 residues), see Phobius details amino acids 156 to 181 (26 residues), see Phobius details amino acids 204 to 223 (20 residues), see Phobius details amino acids 265 to 286 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 83 to 288 (206 residues), 64.2 bits, see alignment E=6.9e-22

Best Hits

Swiss-Prot: 34% identical to Y3749_BRUSU: Probable ABC transporter permease protein BRA0749/BS1330_II0742 (BRA0749) from Brucella suis biovar 1 (strain 1330)

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 99% identity to smk:Sinme_4976)

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, permease protein UgpA (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92VH9 at UniProt or InterPro

Protein Sequence (293 amino acids)

>SM_b21220 ABC transporter for D-Glucosamine, permease component 2 (Sinorhizobium meliloti 1021)
MTGTWISTRAWLLMLPLLVVMTAVIGWPLVDTVRLSFTDAKLVGTEGGFVGTANYIKMLG
GSNFQRALVTTTWFAVISVAAEMVLGVLAALLLNQQFRGRTALRALMILPWALPTVVNAT
LWRLIYNPEYGALNAALTQLGLLDSYRSWLGEPGTALAALIVADCWKNFPLVALIALAAL
QAVPRDITAASLVDGAGPFNRFRFVIMPYLAGPLLVALVLRTIEAFKVFDIIWVMTRGGP
ANSTRTLSILVYQEAFSFQRAGSGASLALIVTLLVTILAAAYAALLRKAAGAS