Protein Info for SM_b21209 in Sinorhizobium meliloti 1021

Annotation: two-component sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 173 to 192 (20 residues), see Phobius details PF02518: HATPase_c" amino acids 353 to 446 (94 residues), 50.3 bits, see alignment E=1.5e-17

Best Hits

KEGG orthology group: K00936, [EC: 2.7.3.-] (inferred from 100% identity to sme:SM_b21209)

Predicted SEED Role

"putative two-component sensor histidine kinase protein( EC:2.7.3.- )"

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92V42 at UniProt or InterPro

Protein Sequence (450 amino acids)

>SM_b21209 two-component sensor histidine kinase (Sinorhizobium meliloti 1021)
MMKSRNPSLIGIVARRVIAFSLLAMILQIGVVFADYWFDDDELSVLMLQEETETLSTAIA
TQDGDLTFKPNHELKERYLERHGPGAIYVRVRTASGSVLFTNCSAECSQHFLPLAVSAPT
FWKRLIAPGKPFSVAGGQSFERHGEVVLVELAVLKDPNGFMYSVLLREMFDSMIVPMTLM
FCLVIGATIWSIRSALKPVAAAVRAADAIDPRDGNARLPSSHMPEEIERLVAAVNRLLAR
VADLIQAQKVFSSSIAHEIRTPVSIAKMELSRIDDPRARNAERDLDALTHILEQLTSLAR
ADAVDPTAFQRADLSAIGAEVAQTTAPFVFDNGKSIEFVDHGTPPVSVIAPLIENMLRNL
IENAVKHNPPNTCIVLTCGPGPLVSVEDDGRGLVDLPEHNDDLGYVKRSGQLGLGLKIVH
RIGELHKARIAVDTVPGGGTKITIDFASAA