Protein Info for SM_b21199 in Sinorhizobium meliloti 1021

Annotation: oligopeptide ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 533 PF00005: ABC_tran" amino acids 29 to 186 (158 residues), 99.1 bits, see alignment E=1.5e-31 amino acids 304 to 455 (152 residues), 106.6 bits, see alignment E=7.5e-34 PF08352: oligo_HPY" amino acids 237 to 267 (31 residues), 18.3 bits, see alignment (E = 1.1e-06) amino acids 506 to 530 (25 residues), 22 bits, see alignment (E = 8.2e-08) PF13401: AAA_22" amino acids 314 to 483 (170 residues), 27.1 bits, see alignment E=2.1e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_4842)

Predicted SEED Role

"Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92V53 at UniProt or InterPro

Protein Sequence (533 amino acids)

>SM_b21199 oligopeptide ABC transporter ATP-binding protein (Sinorhizobium meliloti 1021)
MTEMKDSILAVRGLKVDFYTPDGTVEAVKGIDLDVRSGETLAVVGESGSGKSQTMMGIMG
LLAKNGTVTGSARYRGQELVGLAPKALNKVRGSKITMIFQEPMTSLDPLYTIGRQIAEPI
VHHRGGSFKEARRRVLELLELVGIPEPGRRIDSYPHELSGGQRQRVMIAMALANEPDILI
ADEPTTALDVTIQAQILDLLKSLQRRFGMAIVLITHDLGIVKYFADRVAVMRRGEVVEQG
MTADIFERPKGDYTRMLLEAEPSGRKASPPDNAPIILEGRNVAVDYTIPGGLFRGASAAF
RAVDGVNLRLRQGQTIGIVGESGSGKSTLGRALLRLLPSSGYYRFGSTDISGFDRGAMRP
LRRQLQLVFQDPYGSLSPRRTVGEIITEGLHVHEPDLSRADRDRRAIAALKEVGLDPASR
NRYPHEFSGGQRQRIAIARAIILKPKVVILDEPTSALDRSVQGQVIELLRDLQEKHGLSY
IFISHDLSVVKAMSDYVIVMKNGRIVEEGETDAIFDAPREPYTKTLIGAAFNV