Protein Info for SM_b21191 in Sinorhizobium meliloti 1021

Annotation: surface saccharide ABC transporter ATP-binding/membrane spanning protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 597 transmembrane" amino acids 21 to 51 (31 residues), see Phobius details amino acids 80 to 108 (29 residues), see Phobius details amino acids 155 to 177 (23 residues), see Phobius details amino acids 183 to 204 (22 residues), see Phobius details amino acids 276 to 303 (28 residues), see Phobius details PF00664: ABC_membrane" amino acids 75 to 301 (227 residues), 70.9 bits, see alignment E=1.4e-23 PF00005: ABC_tran" amino acids 374 to 522 (149 residues), 112.4 bits, see alignment E=2.6e-36

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 100% identity to sme:SM_b21191)

Predicted SEED Role

"STRUCTURAL ELEMENTS; Cell Exterior; surface polysaccharides/antigens"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92V59 at UniProt or InterPro

Protein Sequence (597 amino acids)

>SM_b21191 surface saccharide ABC transporter ATP-binding/membrane spanning protein (Sinorhizobium meliloti 1021)
MRRFLLPGLEVLRGALGRQMRLLPAVVILGLASAALEGAGIGLIIPMLGIIAGDGQANGL
SGISAYFQAIGEGLGDGERLLVIAAAVLALIVLKNILAFANTLLTTFIYGKASHAIRSAL
SDQLLRIGYPFFMQQSPGRLLNIISNESWRASDAIQTVLSSIVHGSAAVILLAFLLLMSW
QMTLFVALGLVFVQLAHAALSATLKGPSRHVTSFNSELAARMLHLVHAGRLIRVFGQETR
EKNAFDSASDAVRRAGFALQSRQGALPPLTEVLHSALFLAVVVSAWSIGVSFPVIVAFVV
LLYRLQPHMRALQMSWSQIQGWSGSLEEVRWLLDSSDKPKAPQGNAPVDGLHQGMTFDRV
TFRYPGSEVRPLVLHSASFEIRSGRSTAIIGRSGAGKTTIVNLLCRFVEPDEGRILVDGV
PLGQINPVQWRRQIAVASQDLELVDGTILENITYGQSATPAEAERAAKLAEAHGFIEQLP
QGYETLVGYRGASLSAGQRQRIALARALVRDPAILILDEATNAVDGLSEAAIVETLRSRA
GRRTTIVISHHRSTISFCDDVVVLGSGRVKGQAALADVASLSMDQLYEHETGMGGGG