Protein Info for SM_b21183 in Sinorhizobium meliloti 1021

Annotation: molecular chaperone HtpG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 629 PF13589: HATPase_c_3" amino acids 34 to 160 (127 residues), 39.1 bits, see alignment E=1.1e-13 PF02518: HATPase_c" amino acids 36 to 186 (151 residues), 28.1 bits, see alignment E=3.5e-10 PF00183: HSP90" amino acids 222 to 627 (406 residues), 347.8 bits, see alignment E=2e-107

Best Hits

Swiss-Prot: 100% identical to HTPG_RHIME: Chaperone protein HtpG (htpG) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K04079, molecular chaperone HtpG (inferred from 100% identity to sme:SM_b21183)

Predicted SEED Role

"Chaperone protein HtpG" in subsystem Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P58477 at UniProt or InterPro

Protein Sequence (629 amino acids)

>SM_b21183 molecular chaperone HtpG (Sinorhizobium meliloti 1021)
MSEVETSVEKHVFEADVAKLLHLMVHSVYSDKNVFLRELISNAADACEKLRYEAIVAPEL
LGSDPASRITLTLDEENARLVIEDNGIGMGRDELVESLGTIARSGTRAFMERIEAAQNKD
GAQLIGQFGVGFYSAFMVADNVDVVSRRAGTDKAWHWASDGKGSYTVSAVDLADAPARGT
RITLHLMDEAKTFTSRWTVERIVKEQSGHVPVPISIVEKPGAEPAQVADGTALWTKQKSE
ISKDDYTDFYRGVAGQYDEPALTVHFRAEGRHEYTALAFVPGSKPFDLFDPDRKGRMKLY
VKRVFITDEAELLPRYLRFVRGLVDTADLPLNVSREMIQESPLLANIRKGLTNRVLTSIE
KLAESDSEAFAKIWENFGSVIKEGIYEDFERRGQLLALSRFRTTADDDKPRALSDYVKEM
KEGQSAIYYLTGDNLAQLKASPQLEGFRARGIEVLLLTCPVDSFWVTTAPDFDGKPFKSI
TQGAADLAGIAKNDDAAAASPEAGAAVTDFVSFARETLGEAVSDVRTSDRLTESAVCLVA
PEQGPDRQLQKMLQDAGRIEGAPKPVLEINPGHQLIAALATCPSEDKAFREDAVKLLLDQ
ARVLDGDRPEDPRAFAERLSRVFGRALKE