Protein Info for SM_b21179 in Sinorhizobium meliloti 1021

Annotation: FAD-dependent glycerol-3-phosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details PF00890: FAD_binding_2" amino acids 21 to 60 (40 residues), 24.2 bits, see alignment 2.9e-09 PF01266: DAO" amino acids 21 to 361 (341 residues), 201.1 bits, see alignment E=6e-63 PF13450: NAD_binding_8" amino acids 24 to 71 (48 residues), 31.4 bits, see alignment 2.9e-11

Best Hits

KEGG orthology group: K00119, [EC: 1.1.99.-] (inferred from 100% identity to sme:SM_b21179)

Predicted SEED Role

"Small Molecule Metabolism; Degradation; carbon compounds"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.99.-

Use Curated BLAST to search for 1.1.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92V69 at UniProt or InterPro

Protein Sequence (391 amino acids)

>SM_b21179 FAD-dependent glycerol-3-phosphate dehydrogenase (Sinorhizobium meliloti 1021)
MPEPSLFSAGKLRERYMPNYDVVIIGGGIAGLSLAYFLSPHRSVAVLEREEALGYHSTGR
SAAEFVLRYNAPEICKLATISRAFFDRPPEGFSEVPLLRQRGGVMIAGAGKLDRFEKLLA
EEREFTPEIQRLTKDEALACVPILKPDYVAAAFHDPNFWDIEVENLLQGYVKGARRNGCD
ILERHEILAARHHGSGWLLGTAAGEIGAKVVVNAAGAWADPVAAVFGVSPSGIVPHRRTA
ITVDLPAGIDAAKLPEINEVDEDFYMKPEGGRLLASPADATPCEASDVQPEEIDVAWAAH
YVEEATTVPVRRIVKSWAGLRSFSPDRLPVIGFAPGCPDFFWMAGQGGYGILTSPALGAL
AGTLLRDTAPPAGFRAEGLDPRQFDPGRLQS