Protein Info for SM_b21164 in Sinorhizobium meliloti 1021

Updated annotation (from data): N-formylglutamate deformylase (EC 3.5.1.68)
Rationale: Specifically important for: L-Histidine. KEGG suggests formimidoyl-L-glutamate as the substrate, while SEED suggests N-formylglutamate. This gene is cofit with a deiminase or iminohydrolase (which produces N-formylglutamate) which suggests that the SEED annotation is correct. (SEED_correct)
Original annotation: formiminoglutamase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 TIGR02017: N-formylglutamate deformylase" amino acids 3 to 262 (260 residues), 381 bits, see alignment E=1.5e-118 PF05013: FGase" amino acids 11 to 227 (217 residues), 231.9 bits, see alignment E=5.3e-73

Best Hits

KEGG orthology group: K01479, formiminoglutamase [EC: 3.5.3.8] (inferred from 99% identity to smk:Sinme_4874)

MetaCyc: 44% identical to N-formylglutamate amidohydrolase (Pseudomonas putida)
N-formylglutamate deformylase. [EC: 3.5.1.68]

Predicted SEED Role

"N-formylglutamate deformylase (EC 3.5.1.68)" in subsystem Histidine Degradation (EC 3.5.1.68)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.68

Use Curated BLAST to search for 3.5.1.68 or 3.5.3.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92V79 at UniProt or InterPro

Protein Sequence (271 amino acids)

>SM_b21164 N-formylglutamate deformylase (EC 3.5.1.68) (Sinorhizobium meliloti 1021)
MAVFEVRQGSSPVILGFPHTGTDVPASIRERLNDNGRILADTDWHIHDLYQGLLPDATAV
RATFHRYVIDANRDPAGVSLYPGQNTTGLVPETDFDGLPIWKEGEGPTEVDITERLRDFH
APYHAALSAEIARVKAIHGVVVLYDCHSIRSHIPFLFEGRLPDFNIGTDMGKTCATEIER
AAAEIAAGAECYSHILNGRFKGGWTTRHYGRPEQGVHAIQMELAQSTHLATEAPPFALDR
AKADRLRRPLKAILERIETVAKELKRTGSEA