Protein Info for SM_b21150 in Sinorhizobium meliloti 1021

Annotation: sugar uptake ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 77 to 102 (26 residues), see Phobius details amino acids 113 to 134 (22 residues), see Phobius details amino acids 146 to 165 (20 residues), see Phobius details amino acids 195 to 220 (26 residues), see Phobius details amino acids 252 to 271 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 98 to 277 (180 residues), 46.5 bits, see alignment E=1.8e-16

Best Hits

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 100% identity to sme:SM_b21150)

Predicted SEED Role

"Nucleoside ABC transporter, permease protein 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92V93 at UniProt or InterPro

Protein Sequence (285 amino acids)

>SM_b21150 sugar uptake ABC transporter permease (Sinorhizobium meliloti 1021)
MSQPAMINRYRWYELVGIYGGIFVFLTFILAPFVEGFLVSLKPLGRLFSSPYRFWPENGS
FEAYRTMWVSVPGFARYIFNSFFISIIVTAVVLALVVPAAYAFARFKFRGSGALLAAFLA
VNMFSGAVLLIPLFRLMRSFGVLNTYFAMIVPGVAFLIPSAIWLLRTYMMRIPRELDEAA
FVDGASHFYTLRRVILPIAMPGITVVAITTFIGSYAQQFIFALTFNSKSEYMPLPVGLFA
YFGRQEVVWNELMAASFVGIAPAVIVIFFLQRYLVSGLTAGAVKQ