Protein Info for SM_b21149 in Sinorhizobium meliloti 1021

Annotation: sugar uptake ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 transmembrane" amino acids 7 to 30 (24 residues), see Phobius details amino acids 71 to 93 (23 residues), see Phobius details amino acids 104 to 124 (21 residues), see Phobius details amino acids 155 to 176 (22 residues), see Phobius details amino acids 206 to 232 (27 residues), see Phobius details amino acids 264 to 284 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 99 to 282 (184 residues), 44.5 bits, see alignment E=7.3e-16

Best Hits

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 100% identity to smk:Sinme_4889)

Predicted SEED Role

"ABC sugar transporter, inner membrane subunit"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92V94 at UniProt or InterPro

Protein Sequence (294 amino acids)

>SM_b21149 sugar uptake ABC transporter permease (Sinorhizobium meliloti 1021)
MSVRRSTIIFAWVLLLPAVFYVTVIVAYPLVDTFVLSFTDASLKKTTKWVGTANYDKIFN
ATFAEVILRTFVWTAFSVTIKMIIGTFGAVMLNAAVPGRALFRVLTMPPWIVPMAIGIFM
WGWMYNGQFGMISGTLQNWGLVDGPVAFLAHGSTAFWATIVTDVWIGVPLVTLYMLASMQ
AIPQDLYEAAWTDGAGRFYRFRRITLPLLVPSMITMSMLSLIATFNSFDIIWILTQGGPN
GDTTTMIIDTYRTAIGSKKYGEGAARAVLICIFLSIFCIAYFRVTHRLATGESR