Protein Info for SM_b21137 in Sinorhizobium meliloti 1021

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 transmembrane" amino acids 20 to 49 (30 residues), see Phobius details amino acids 61 to 80 (20 residues), see Phobius details amino acids 91 to 109 (19 residues), see Phobius details amino acids 124 to 139 (16 residues), see Phobius details amino acids 157 to 173 (17 residues), see Phobius details amino acids 184 to 204 (21 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 15 to 110 (96 residues), 90.2 bits, see alignment E=5.3e-30 PF00528: BPD_transp_1" amino acids 34 to 215 (182 residues), 80.2 bits, see alignment E=8.3e-27

Best Hits

Swiss-Prot: 33% identical to YCKA_BACSU: Probable amino-acid ABC transporter permease protein YckA (yckA) from Bacillus subtilis (strain 168)

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 99% identity to smk:Sinme_4984)

Predicted SEED Role

"Amino acid ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92VI7 at UniProt or InterPro

Protein Sequence (219 amino acids)

>SM_b21137 amino acid ABC transporter permease (Sinorhizobium meliloti 1021)
MDFSFLDQLWLARIPLLKGLGVSVSISLLSIVVGTVLGVFVGLALVYGFRPVKWIVRGYT
DFIRGTPVLVLVLASYYVLSTIGIDLGPFQAGVLALAVFCSSHVGELVRGALQSIPKGQT
EAAKAIGLTFAQTFTYVLGPQALRQALPAWVNTAAEMVKASTLLSIIGVSELLLRTQELI
SRTFMSLEFYFFAGFLYFVINYGIERFGRYVERKTAVPS