Protein Info for SM_b21132 in Sinorhizobium meliloti 1021

Annotation: sulfate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 transmembrane" amino acids 20 to 47 (28 residues), see Phobius details amino acids 70 to 96 (27 residues), see Phobius details amino acids 108 to 130 (23 residues), see Phobius details amino acids 142 to 166 (25 residues), see Phobius details amino acids 198 to 216 (19 residues), see Phobius details amino acids 224 to 245 (22 residues), see Phobius details amino acids 254 to 278 (25 residues), see Phobius details TIGR00969: sulfate ABC transporter, permease protein" amino acids 16 to 278 (263 residues), 312.4 bits, see alignment E=2.8e-97 TIGR02139: sulfate ABC transporter, permease protein CysT" amino acids 19 to 282 (264 residues), 413.8 bits, see alignment E=3.3e-128 PF00528: BPD_transp_1" amino acids 85 to 284 (200 residues), 72.8 bits, see alignment E=1.5e-24

Best Hits

Swiss-Prot: 52% identical to CYST_SYNY3: Sulfate transport system permease protein CysT (cysT) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K02046, sulfate transport system permease protein (inferred from 99% identity to smk:Sinme_4989)

MetaCyc: 49% identical to sulfate/thiosulfate ABC transporter inner membrane subunit CysU (Escherichia coli K-12 substr. MG1655)
ABC-19-RXN [EC: 7.3.2.5]; ABC-7-RXN [EC: 7.3.2.5, 7.3.2.3]; 7.3.2.3 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-478 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-479 [EC: 7.3.2.5, 7.3.2.3]

Predicted SEED Role

"Sulfate transport system permease protein CysT" in subsystem Cysteine Biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.3 or 7.3.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92VJ0 at UniProt or InterPro

Protein Sequence (288 amino acids)

>SM_b21132 sulfate ABC transporter permease (Sinorhizobium meliloti 1021)
MISMAARSSTRWRFRQPSVIPGFGLALGVTLAWLTIIVLIPLSGLLWRSSGLGWSKFVEL
ALDERTVNALTISFGTAFIAAVVNLVFGVLLAWVLVRYRFPGKRVIDAMVDLPFALPTAV
AGIALTTLYAPNGWIGSLLAPLGIKIAFTPAGIVVALIFVGLPFVVRTVQPIMEEIDKEV
EEAAATLGATRFQTISRVLLPGLLPAGLTGFALAFARGVGEYGSVIFIAGNLPYVSEIAP
LLIVIRLEEFNYPAATAIAAVMLLLSFMMLLVINVIQAWSRRRYGYGA