Protein Info for SM_b21111 in Sinorhizobium meliloti 1021

Annotation: oxidoreductase, RED superfamily protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF00106: adh_short" amino acids 8 to 189 (182 residues), 149 bits, see alignment E=1.9e-47 PF01370: Epimerase" amino acids 10 to 185 (176 residues), 25.3 bits, see alignment E=1.4e-09 PF13561: adh_short_C2" amino acids 15 to 243 (229 residues), 186.4 bits, see alignment E=9.6e-59

Best Hits

Swiss-Prot: 59% identical to FUCDH_XANCP: 2-keto-3-deoxy-L-fuconate dehydrogenase (XCC4067) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_5008)

MetaCyc: 60% identical to 2-dehydro-3-deoxy-D-pentonate/2-dehydro-3-deoxy-L-fuconate 4-dehydrogenase (Herbaspirillum huttiense)
RXN-22641 [EC: 1.1.1.434]; 1.1.1.434 [EC: 1.1.1.434]

Predicted SEED Role

"2-keto-3-deoxy-L-fuconate dehydrogenase" in subsystem L-fucose utilization temp

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.434

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92VL1 at UniProt or InterPro

Protein Sequence (244 amino acids)

>SM_b21111 oxidoreductase, RED superfamily protein (Sinorhizobium meliloti 1021)
MTANLAGKVVLVTAAAQGIGRATALAFAKAGAKVHATDINADAVGSLEGEAGISTHRLDV
LDTAAVEALVAEIGAVDVLFNCAGFVHAGSVLTMKDEDLDFAFDLNVKSMIRTIRAVLPG
MIARKDGSIVNMASVASSIKGVPNRFAYGVTKAAVIGLTKAVAADYVGDGIRCNAICPGT
VESPSLESRMRAQGDYETARAAFISRQPMGRLGTPEEIADLAVYLAGATYTSGQAYAIDG
GWTI