Protein Info for SM_b21101 in Sinorhizobium meliloti 1021

Updated annotation (from data): L-fucono-1,5-lactonase; D-arabinolactonase
Rationale: Specifically important in carbon source D-Arabinose; carbon source L-Fucose. A related protein (29% identical) was shown by Hobbs et al (2013) to be a L-fucono-1,5-lactonase. Note that D-arabinolactone is chemically similar to L-fuconolactone, with one methyl group replaced with a hydrogen.
Original annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 PF04909: Amidohydro_2" amino acids 3 to 277 (275 residues), 211.1 bits, see alignment E=1.4e-66

Best Hits

KEGG orthology group: K07046, (no description) (inferred from 100% identity to sme:SM_b21101)

Predicted SEED Role

"L-fuconolactone hydrolase" in subsystem L-fucose utilization temp

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92VM0 at UniProt or InterPro

Protein Sequence (278 amino acids)

>SM_b21101 L-fucono-1,5-lactonase; D-arabinolactonase (Sinorhizobium meliloti 1021)
MIIDTHLHLIDKSALNYPWLAGVPALDRDFLYATYAAEAKRVGVAASLHMEVDVDPAEIE
LETREVARLAGEPGSLLKGAIAACRPEDEGFAAYLERQEENAFVKGFRRVLHVVTDDLSE
QPLFRENVKRLSGTRFTFDLCVLPHQIPKAIALADLAPDVQFILDHCGVPDIKGHAEHPW
RDHMTEIARHPNVVAKISGVVAYAEEDWALDSIRPYVEHTISVFGWDRVVWGSDWPVCTL
GGNLSTWVAATQALIEGCSPQERRKLLSGNAQRIWNLI