Protein Info for SM_b21096 in Sinorhizobium meliloti 1021

Annotation: amino acid transporter ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 PF00005: ABC_tran" amino acids 22 to 180 (159 residues), 122.7 bits, see alignment E=1.7e-39 PF13304: AAA_21" amino acids 105 to 211 (107 residues), 33.1 bits, see alignment E=6e-12

Best Hits

Swiss-Prot: 52% identical to OCCP_AGRT4: Octopine permease ATP-binding protein P (occP) from Agrobacterium tumefaciens (strain Ach5)

KEGG orthology group: K02028, polar amino acid transport system ATP-binding protein [EC: 3.6.3.21] (inferred from 100% identity to sme:SM_b21096)

Predicted SEED Role

"Methionine ABC transporter ATP-binding protein" in subsystem Methionine Biosynthesis or Methionine Degradation

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.21

Use Curated BLAST to search for 3.6.3.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92VM4 at UniProt or InterPro

Protein Sequence (256 amino acids)

>SM_b21096 amino acid transporter ABC transporter ATP-binding protein (Sinorhizobium meliloti 1021)
MNQGILVKAIDVTKNYGTFRALDKVSLEVARGEVSCIIGPSGSGKSTLLRCINLLERMDG
GAIWVKDELIGYRRDGNNLHEISDAEISRQRRRIGMVFQRFNLFPHKTALENIIEGPVQV
LGEPVNEARDRAAALLERVGLADKANHYPSELSGGQQQRVAIARAMGMRPDLILFDEPTS
ALDPELVSEVLDVMRDLAASGMTMIVVTHELGFARNVANTVTFMETGKVVETGLASEVLS
TPKSARTAEFIKAVHS