Protein Info for SM_b21095 in Sinorhizobium meliloti 1021

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 transmembrane" amino acids 31 to 50 (20 residues), see Phobius details amino acids 63 to 94 (32 residues), see Phobius details amino acids 100 to 117 (18 residues), see Phobius details amino acids 123 to 142 (20 residues), see Phobius details amino acids 149 to 167 (19 residues), see Phobius details amino acids 253 to 275 (23 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 64 to 174 (111 residues), 64.3 bits, see alignment E=6.1e-22 PF00528: BPD_transp_1" amino acids 85 to 277 (193 residues), 67.4 bits, see alignment E=6.9e-23

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 100% identity to sme:SM_b21095)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92VM5 at UniProt or InterPro

Protein Sequence (290 amino acids)

>SM_b21095 amino acid ABC transporter permease (Sinorhizobium meliloti 1021)
MNVASLATQPSDSKYEIAHLKLVPKRHIGRTIAAGVVLLLFAGLVRAFSVGQIEWSYVRD
FLFAPAILAGLYNTLLMTVAAMGLGIVLGVVIAIMRISGNPVLSLIAIGYIWVFRGAPAL
LQLMLWFNLALIFPTFGIPGLFEFRTVDVMTPFVAAVLGLGISQGAYTSEVVRSGLLSVD
SGQYEAARTIGMTQMKMLRRIVLPQAMRVMVPPVGNEVIGMVKLTSLASVIQYSEILHNA
QIIYFANTRVLELLLVASFWYLLVVSVLSIGQHYIERYFGRGSKSIRSSM