Protein Info for SM_b21085 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 transmembrane" amino acids 416 to 432 (17 residues), see Phobius details PF13007: LZ_Tnp_IS66" amino acids 58 to 137 (80 residues), 58.1 bits, see alignment E=2.4e-19 PF13005: zf-IS66" amino acids 146 to 186 (41 residues), 51.7 bits, see alignment 1.9e-17 PF03050: DDE_Tnp_IS66" amino acids 204 to 495 (292 residues), 320.8 bits, see alignment E=1.7e-99 PF13817: DDE_Tnp_IS66_C" amino acids 502 to 540 (39 residues), 65.7 bits, see alignment 6.8e-22

Best Hits

Swiss-Prot: 41% identical to Y4QI_SINFN: Uncharacterized protein y4qI (NGR_a01890) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K07484, transposase (inferred from 100% identity to sme:SM_b21085)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92VN5 at UniProt or InterPro

Protein Sequence (550 amino acids)

>SM_b21085 hypothetical protein (Sinorhizobium meliloti 1021)
MSSPLDLSLFPNLPPEVVKAFAAMQFELSVERAARQHEQAVVAEKDAFIAELKELVEKLE
GQVHDYRRTKFGPKSEKLDPAQMELALEDLETAIAETQARIAAVEKKIEASASDPEKVAP
RKERKARALPEHLPRVERVIEPESIVCPCGCGNMVRIGEDRTERLDRVPARYEVIVTIRP
KYACPKGRTGVVQARAPAHLLEGSWPTEALLAEIAVSKHSEHMPLNRQAEVMARHGVPID
RTVLADWMGRTGAAIAPVVDHMAKRLLWESTRLYVDETTAPVLDPGRGKTKTGYLWAVLR
DDRGWNGSAPPGVVFHYRPGRKGEYAAEILDGFNGTIQVDAYGGYSHLATLDRVGGDPLK
LAFCWAHGRRKLIKATPKSGSPIVDEALVRIAALYKIEDSIRGSDPEHRRAVRQDLSLPL
VGAFFAWLAAQAKRVSRKSDLGKALAYMLTRQDGFRLFLDDGHVDIDSNLVENAIRRPAM
NRRNALFAGHDEGGRNWARFASLIGTCKMNGVEPYAYLCDLFTRLANGHLAKDIDALMPW
AYAARITASQ