Protein Info for SM_b21071 in Sinorhizobium meliloti 1021

Annotation: UDP-phosphate galactosephosphotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 59% identical to EXOY_RHIME: Exopolysaccharide production protein ExoY (exoY) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 100% identity to sme:SM_b21071)

MetaCyc: 59% identical to undecaprenyl-phosphate galactose phosphotransferase (Sinorhizobium meliloti 1021)
Undecaprenyl-phosphate galactose phosphotransferase. [EC: 2.7.8.6]

Predicted SEED Role

"Undecaprenyl-phosphate galactosephosphotransferase (EC 2.7.8.6)" (EC 2.7.8.6)

MetaCyc Pathways

succinoglycan biosynthesis (13/14 steps found)
Salmonella enterica serotype O:3,10 O antigen biosynthesis (1/5 steps found)
Porphyromonas gingivalis O-LPS antigen biosynthesis (1/6 steps found)
Salmonella enterica serotype O:2 O antigen biosynthesis (1/6 steps found)
Salmonella enterica serotype O:4 O antigen biosynthesis (group B1) (1/6 steps found)
Salmonella enterica serotype O:9 O antigen biosynthesis (1/6 steps found)
Salmonella enterica serotype O:9,46 O antigen biosynthesis (1/6 steps found)
Salmonella enterica serotype O:8 O antigen biosynthesis (1/8 steps found)
Salmonella enterica serotype O:9,46,27 O antigen biosynthesis (1/9 steps found)

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.6

Use Curated BLAST to search for 2.7.8.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92VP9 at UniProt or InterPro

Protein Sequence (216 amino acids)

>SM_b21071 UDP-phosphate galactosephosphotransferase (Sinorhizobium meliloti 1021)
MAIARPHGPDLQPLGGRPKRGLDLAVASTALVLALPLMAVVALLIKVITGGPVLFVHRRI
GFNGTPFDCYKFRTMAENADQVLEEYLACNPRAAEEWRETQKLKNDPRTTLLGQMLRMSS
LDELPQLINIIRGEMSCVGPRPIVAGEMSRYGAVAYEYLKTRPGLTGLWQISGRNDIDYA
SRVALDAQYVRNWSIWTDLIILAKTAYAVMRFDEAS