Protein Info for SM_b21061 in Sinorhizobium meliloti 1021

Annotation: NDP-hexose 3-C-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 PF08421: Methyltransf_13" amino acids 14 to 75 (62 residues), 75.1 bits, see alignment E=1.1e-24 PF13489: Methyltransf_23" amino acids 109 to 248 (140 residues), 60.6 bits, see alignment E=4.8e-20 PF13649: Methyltransf_25" amino acids 112 to 203 (92 residues), 29.9 bits, see alignment E=2.3e-10 PF08241: Methyltransf_11" amino acids 114 to 207 (94 residues), 35.2 bits, see alignment E=5e-12 PF08242: Methyltransf_12" amino acids 114 to 204 (91 residues), 44.7 bits, see alignment E=5.7e-15 PF08484: Methyltransf_14" amino acids 256 to 410 (155 residues), 198 bits, see alignment E=2.6e-62

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SM_b21061)

Predicted SEED Role

"methyltransferase, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92VQ9 at UniProt or InterPro

Protein Sequence (415 amino acids)

>SM_b21061 NDP-hexose 3-C-methyltransferase (Sinorhizobium meliloti 1021)
MLHETLNSVTEHACRSCGGTRLETFLDLGATPLVDRLLVDGDIDKPELIFPLRVAFCRDC
SLAQITETVSPNILFADDYPYYSSFSPALLEHSRENALSLIACRNLGPESLVIELASNDG
YLLKNYVEAGVKVLGIDPADGPAAAAERIGVQTRCTFFTRDLAETLRAEGAVADVIHANN
VLAHVADTNGFVAGIARLLKEDGVAVIEVPYVVPLIEHCEFDTIYHEHLCYFSVTALDRL
FRRHGLYLNEIKPLSIHGGSLRLYVELRQRVGAAVKKRLAQETALGIDTIDYFRNFSAKV
DVLKRELLALLHRLKSEGSSIAAYGAAAKGATLINTIGIGRDLIDFVVDRNVHKQGKYMP
GQRLPIRSTEALVQAQPDYVLLLAWNFADEILAQQADYHTRGGKFIIPVPVPRIL