Protein Info for SM_b21048 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 481 transmembrane" amino acids 6 to 66 (61 residues), see Phobius details amino acids 85 to 103 (19 residues), see Phobius details amino acids 137 to 155 (19 residues), see Phobius details amino acids 167 to 187 (21 residues), see Phobius details amino acids 222 to 240 (19 residues), see Phobius details amino acids 247 to 263 (17 residues), see Phobius details amino acids 269 to 287 (19 residues), see Phobius details amino acids 296 to 315 (20 residues), see Phobius details amino acids 374 to 398 (25 residues), see Phobius details amino acids 412 to 432 (21 residues), see Phobius details amino acids 438 to 455 (18 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SM_b21048)

Predicted SEED Role

"Cytochrome c-type biogenesis protein DsbD, protein-disulfide reductase (EC 1.8.1.8)" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange (EC 1.8.1.8)

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.8

Use Curated BLAST to search for 1.8.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92VS2 at UniProt or InterPro

Protein Sequence (481 amino acids)

>SM_b21048 hypothetical protein (Sinorhizobium meliloti 1021)
MQISFVGLLICAGILVIGYYCRAPLIIGLIVSLAFGATAVMTLSAIGGSSPLIYTFFAAL
LITAVVSRRRMWRDLGHVFGKIRPVWVLTGLMLYAMVGAWLFPRFFAGQTSVFVQAAMRR
GVIEAPLAPVSGNITQTGYFVLGGLTAIALCVLLLHENRLESIRRGFLLWCSVHVVFGLL
DLLGKVAGAGDILSPIRTASYAMLTEVIENGFWRITGAASEASSFGGGSLVCLSFCYVYW
RKTKSRVAQALAFLLLVLLLLSTSSVAYVGLAVLSIPVALSISWSFLSGRMDKDEILIIA
LLALAAVTVLAIVQYDEEFFAPFVHLIDSMVLNKASSASGQERAYWNIKSLQAFVETGGL
GVGLGSSRASSWPIAVASQLGLVGGVMMVTLLLVILRGMGSLKGHIDPETNAVVSSVQAC
ALGSVAAGSLGAGSADPGMIFFIALAVISTSRVNARKSRDATIRTIQLGQPEPLAYRPAT
H