Protein Info for SM_b21039 in Sinorhizobium meliloti 1021

Annotation: oligopeptidemurein peptide ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 89 to 115 (27 residues), see Phobius details amino acids 127 to 147 (21 residues), see Phobius details amino acids 153 to 174 (22 residues), see Phobius details amino acids 196 to 218 (23 residues), see Phobius details amino acids 256 to 277 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 105 to 287 (183 residues), 97.8 bits, see alignment E=3.4e-32

Best Hits

Swiss-Prot: 35% identical to DPPC_ECOLI: Dipeptide transport system permease protein DppC (dppC) from Escherichia coli (strain K12)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 99% identity to smk:Sinme_5826)

MetaCyc: 35% identical to dipeptide ABC transporter membrane subunit DppC (Escherichia coli K-12 substr. MG1655)
ABC-8-RXN [EC: 7.4.2.9]

Predicted SEED Role

"putative oligopeptidemurein peptide ABC transporter permease protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92VT8 at UniProt or InterPro

Protein Sequence (291 amino acids)

>SM_b21039 oligopeptidemurein peptide ABC transporter permease (Sinorhizobium meliloti 1021)
MKAQIVSALKRRRHGPVLTASKLLLASYILVAIAAPLIAPQNPYDPLQIYGWEASSPPGT
RGSGGYLYLLGTDGLGRDIVSTILYGLRISLVVSIVSSALAALIGLTAGVSAAYFGKWVD
IAIMRLVDLQLSLPTILIALIAIVTLGPGIDRIILALIIAQWATYARIARGVALSEANKP
YMDAARLMRLPTSRIIFRHLLPNSIAPAVTLIPIEVGHAVALEATLSFLGLGVPIDKPSL
GSAVANGFQYLLTGQYWISLFPGLALFGLIASINLVGEDVRRSLDPRNHSR