Protein Info for SM_b20980 in Sinorhizobium meliloti 1021

Annotation: small C4-dicarboxylate uptake permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 55 to 76 (22 residues), see Phobius details amino acids 96 to 116 (21 residues), see Phobius details amino acids 136 to 154 (19 residues), see Phobius details PF04290: DctQ" amino acids 31 to 152 (122 residues), 79.4 bits, see alignment E=1.2e-26

Best Hits

KEGG orthology group: None (inferred from 99% identity to smk:Sinme_4610)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92UM1 at UniProt or InterPro

Protein Sequence (170 amino acids)

>SM_b20980 small C4-dicarboxylate uptake permease (Sinorhizobium meliloti 1021)
MESSRSPEETIPLFSLRRADEAIGVAALLVIVFSILWGVVSRYVFPQPAAWTYELAMMVF
AYLVFFGAVAGVRLGTHAAIDVLVAALPDSWRKAVAWFNYLLLALFFIVMTILFAWQAWT
SRNVHTIALDLSRSLSYAPLALASAGMFVQHLIVERPWVARQHRNLESLI