Protein Info for SM_b20964 in Sinorhizobium meliloti 1021

Annotation: Ahp/CTSA family anti-oxidant protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 PF00578: AhpC-TSA" amino acids 5 to 143 (139 residues), 103.1 bits, see alignment E=1.6e-33 PF08534: Redoxin" amino acids 6 to 143 (138 residues), 41 bits, see alignment E=2.6e-14 PF10417: 1-cysPrx_C" amino acids 166 to 202 (37 residues), 48.6 bits, see alignment 9.5e-17

Best Hits

Swiss-Prot: 46% identical to REHY_WHEAT: 1-Cys peroxiredoxin PER1 (PER1) from Triticum aestivum

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_4626)

Predicted SEED Role

"Alkyl hydroperoxide reductase subunit C-like protein" in subsystem Oxidative stress or Rubrerythrin or Thioredoxin-disulfide reductase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7ANN8 at UniProt or InterPro

Protein Sequence (219 amino acids)

>SM_b20964 Ahp/CTSA family anti-oxidant protein (Sinorhizobium meliloti 1021)
MSLRINDTAPDFTAETTQGTINFHEWIGDGWAVLFSHPKNFTPVCTTELGAMAGIEPEFR
KRGVKIIGISVDPVESHSKWKNDIKVATGFEVDYPLIGDRDLKVAKLYDMLPAGAGETSE
GRTPADNATVRSVYVIGPDKKIKLILTYPMTTGRNFNEILRAIDSIQLTAKHQVATPANW
QQGEDVIITAAVSNEDAVQRFGSFDTVLPYLRKTKQPTA