Protein Info for SM_b20941 in Sinorhizobium meliloti 1021

Annotation: MsbA-like saccharide exporting ABC transporter ATP-binding/permease subunits

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 604 signal peptide" amino acids 1 to 45 (45 residues), see Phobius details transmembrane" amino acids 68 to 90 (23 residues), see Phobius details amino acids 150 to 173 (24 residues), see Phobius details amino acids 178 to 200 (23 residues), see Phobius details amino acids 262 to 285 (24 residues), see Phobius details amino acids 290 to 308 (19 residues), see Phobius details PF00664: ABC_membrane" amino acids 33 to 307 (275 residues), 67.3 bits, see alignment E=1.8e-22 PF00005: ABC_tran" amino acids 372 to 520 (149 residues), 108.6 bits, see alignment E=3.9e-35

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_4649)

Predicted SEED Role

"Transport ATP-binding protein CydCD" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7ANN9 at UniProt or InterPro

Protein Sequence (604 amino acids)

>SM_b20941 MsbA-like saccharide exporting ABC transporter ATP-binding/permease subunits (Sinorhizobium meliloti 1021)
MAFTRFTARNRAFRSVFRFSWDHWKKQPVRLAALLLTVLLSTLADVLTPLYSGRLVDAVI
SGAASDDVAWNAAMAAFMMLMALSFGAIILRHVTFMGIVSLTLKMMSDIAAAAFHHIQRF
SSDWHANSFAGSTVRKVTRGMWALDLLNDTLLVALFPSIVMLVGSTALMAWYWPMMGVII
GLGSIAFIAVTVSLSLGYVAPMASLANSWDTRLGGALADAVSCNTVVKAFGAEGREDARL
AKVLRKWENRTRRTWSRGTLNGTAQGAMLLVLRAAVIGFALLLWARGQATAGDITFVLTS
FFILQGYLREVGMHIRNLQRSINDMEELVAIHAQPLGVEDRPGAKPIRITEGEIEFRDVT
FHYGAHRAPLYEGFSVNIAAGERVGLVGHSGSGKTTFIKLIQRLHDLNAGEIRIDGQNIA
DFTQASLRQQIAIVQQEPILFHRSLAENIAYARPGATQRDIEEAARLASAHDFIAALPKG
YGTLVGERGVKLSGGERQRVAIARAFLADAPILILDEATSSLDSESEVLIQQAMERLMTG
RTTLVVAHRLSTVRALDRLLVFDRGRIAEEGDHGALIRVKGGIYRSLFERQALELTKGLI
LSEG