Protein Info for SM_b20939 in Sinorhizobium meliloti 1021

Annotation: 6-pyruvoyl-tetrahydropterin synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03367: queuosine biosynthesis protein QueD
  • amino acids 4 to 96 (93 residues), 98.6 bits, E=1.1e-32
• PF01242: PTPS
  • amino acids 5 to 118 (114 residues), 112.8 bits, E=5.1e-37

Best Hits

Swiss-Prot: 36% identical to QUED_SHIFL: 6-carboxy-5,6,7,8-tetrahydropterin synthase (queD) from Shigella flexneri

KEGG orthology group: K01737, 6-pyruvoyl tetrahydrobiopterin synthase [EC: 4.2.3.12] (inferred from 100% identity to smk:Sinme_4651)

MetaCyc: 36% identical to 6-carboxy-5,6,7,8-tetrahydropterin synthase (Escherichia coli K-12 substr. MG1655)
RXN0-5507 [EC: 4.1.2.50]

Predicted SEED Role

No annotation

MetaCyc Pathways

• drosopterin and aurodrosopterin biosynthesis (5/7 steps found)
• erythro-tetrahydrobiopterin biosynthesis I (2/4 steps found)
• threo-tetrahydrobiopterin biosynthesis (2/4 steps found)
• preQ₀ biosynthesis (2/4 steps found)

KEGG Metabolic Maps

• Folate biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.50 or 4.2.3.12

Sequence Analysis Tools

See Q7ANP0 at UniProt or InterPro

Protein Sequence (119 amino acids)

>SM_b20939 6-pyruvoyl-tetrahydropterin synthase (Sinorhizobium meliloti 1021)
MMFRITKEFHFSASHQLKSLPAEHQCARLHGHNYIVEVELSGETLNEHGFVRDYHELAPL
KQYIDECFDHRHLNDVLGHDRVTAECLAQHFYEWCQARLPETTAVRVSETAKTWAEYRP