Protein Info for SM_b20929 in Sinorhizobium meliloti 1021

Annotation: sugar uptake ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 transmembrane" amino acids 18 to 43 (26 residues), see Phobius details amino acids 55 to 76 (22 residues), see Phobius details amino acids 81 to 102 (22 residues), see Phobius details amino acids 107 to 149 (43 residues), see Phobius details amino acids 172 to 196 (25 residues), see Phobius details amino acids 227 to 250 (24 residues), see Phobius details amino acids 263 to 291 (29 residues), see Phobius details amino acids 298 to 322 (25 residues), see Phobius details PF02653: BPD_transp_2" amino acids 52 to 319 (268 residues), 130.6 bits, see alignment E=3.2e-42

Best Hits

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 100% identity to smk:Sinme_4660)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92UP3 at UniProt or InterPro

Protein Sequence (332 amino acids)

>SM_b20929 sugar uptake ABC transporter permease (Sinorhizobium meliloti 1021)
MAITLDRAVGQRDRGWLSFLLASQAFWVLVAVILACLFLSIATDSFATAKNLYNITRNFT
FVAIIALGMTLVIITGGIDLSVGSVLCLCSMVLAVVMHAGYGIEVGIAASIGTALVAGAF
NGVMIAYLGFPPFVITLGMLSIARSLAMVASNNTVVFEFGPDHDTLLALGGGAWFLGIAN
PVLYMIVLALLTGFVLRWTKFGRYVFAIGGNEHAATLTGVPVRRIKVAVYMISALAAGIA
GIIQTGWLGAVTTNIGAGMELQVIAAAVIGGANLAGGAGTASGALIGAALIEVIRNSLGL
LGINAFWQGAFIGGAIVLAVLFDRIRNFRQSE