Protein Info for SM_b20925 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 transmembrane" amino acids 7 to 31 (25 residues), see Phobius details amino acids 41 to 64 (24 residues), see Phobius details amino acids 98 to 120 (23 residues), see Phobius details amino acids 137 to 157 (21 residues), see Phobius details amino acids 181 to 215 (35 residues), see Phobius details PF02163: Peptidase_M50" amino acids 46 to 121 (76 residues), 59.9 bits, see alignment E=2.4e-20 amino acids 136 to 192 (57 residues), 34.2 bits, see alignment E=1.8e-12 PF00571: CBS" amino acids 233 to 288 (56 residues), 40 bits, see alignment 4.2e-14 amino acids 300 to 344 (45 residues), 17.1 bits, see alignment 5.8e-07

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_4664)

Predicted SEED Role

"Putative zinc metalloprotease MJ0392 (EC 3.4.24.-)" (EC 3.4.24.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92UP7 at UniProt or InterPro

Protein Sequence (372 amino acids)

>SM_b20925 hypothetical protein (Sinorhizobium meliloti 1021)
MAWSFSIGTIAGTAIRVHVTFALLLIWIWLMHYRIGGTPAAMEGIAFIVAVFVCVVLHEF
GHIAAARRFGIKTPDITLLPIGGVARLERMPEEPGQEFVIAIAGPLVNVAIAAVLIAILG
SSGMEQIAGVEDPQSGFLARLAGVNVFLVIFNMIPAFPMDGGRVLRAALASRLTWSRATQ
IAATIGQGLAFVFGFVGLFYNPLLIFIAIFVYLAATAEAQNAQIREISGSVMISDVMITE
FATLDRSATIDDAIDTLLATTQREFPVVDAAGHFEGLLTRDDMIRALKEKGPSTPVVAAM
RRGLPTIHYRKRLEESLRLMQESHSPAIAVLDGSNHLVGLMTHETIGEMMMVRAAAPGRV
RFGHLRQTGSRS