Protein Info for SM_b20919 in Sinorhizobium meliloti 1021

Annotation: transposase of insertion sequence ISRm1 orfB protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 PF13276: HTH_21" amino acids 34 to 90 (57 residues), 39.1 bits, see alignment E=1.1e-13 PF00665: rve" amino acids 107 to 212 (106 residues), 67.7 bits, see alignment E=1.4e-22 PF13683: rve_3" amino acids 202 to 266 (65 residues), 53.5 bits, see alignment E=2.4e-18

Best Hits

Swiss-Prot: 54% identical to INSD1_ECOLI: Transposase InsD for insertion element IS2A (insD1) from Escherichia coli (strain K12)

KEGG orthology group: K07497, putative transposase (inferred from 100% identity to sme:SMc03948)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (276 amino acids)

>SM_b20919 transposase of insertion sequence ISRm1 orfB protein (Sinorhizobium meliloti 1021)
MKSVCETLGVARSNIAARAAGSPSRARGRPPLPDRELVEDIKAVIADMPTYGYRRVHAIL
RRNARKLGRSWPNAKRVYRVMKLHNLLLVRHTGAVDNRLHEGQVAVERSNIRWCSDGFEI
GCDNKEKVRVAFALDCCDREAIAHVATTEGIKSQDVQDLVITAVENRFGRINMLSEPIEW
LTDNGSCFIAKDTASLLRDIGMEPCTTPVRSPQSNGMAEAFVKTFKRDYVAVNPTPDAET
VMAQLPFWFEHYNNLHPHSALGYQSPREFISSQSQT