Protein Info for SM_b20912 in Sinorhizobium meliloti 1021

Annotation: ATP-dependent DNA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 transmembrane" amino acids 115 to 134 (20 residues), see Phobius details TIGR02779: DNA ligase D, ligase domain" amino acids 24 to 311 (288 residues), 289.6 bits, see alignment E=1.4e-90 PF01068: DNA_ligase_A_M" amino acids 36 to 207 (172 residues), 116.6 bits, see alignment E=1.9e-37 PF04679: DNA_ligase_A_C" amino acids 227 to 311 (85 residues), 60.3 bits, see alignment E=3.1e-20

Best Hits

KEGG orthology group: K01971, DNA ligase (ATP) [EC: 6.5.1.1] (inferred from 100% identity to sme:SM_b20912)

Predicted SEED Role

"ATP-dependent DNA ligase (EC 6.5.1.1)" in subsystem DNA Repair Base Excision or DNA replication, archaeal (EC 6.5.1.1)

Isozymes

Compare fitness of predicted isozymes for: 6.5.1.1

Use Curated BLAST to search for 6.5.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92UC4 at UniProt or InterPro

Protein Sequence (364 amino acids)

>SM_b20912 ATP-dependent DNA ligase (Sinorhizobium meliloti 1021)
MARASSKKPRDTPPLDPMPARIDPCLASLVDRPPKGPDWAFEVKWDGYRIAVHIEPGRVR
ILTRGGYDWTERFPTIVDDARRLAVKTAILDGEAVVLDDKGRSDFGMLQRALGRLPSAVE
AGAIVFYAFDLLYLDGHDLRRLPLRERRRLLEPLVAAREGAVRLSEELQADGDEFFRVAC
AHGLEGIIAKHIEKPYRSGRGEWWQKITCKSRDSFVIVGFEPSTVPGHLGRLLLAAREGD
EPVYVGGCGTGWSNKLSRELRKLLEGMATKSPAVDLRRRAAVSVEPVHVADVEYRAWTDD
GKLRHASFKGIGSGRMTWRLFSGTLVVNSGCTEFTPNAVLESCRLTFVKRFATRGGDNTP
KIYQ