Protein Info for SM_b20902 in Sinorhizobium meliloti 1021

Annotation: sugar uptake ABC transporter substrate-binding protein precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF13407: Peripla_BP_4" amino acids 28 to 284 (257 residues), 219.5 bits, see alignment E=6e-69 TIGR02634: D-xylose ABC transporter, D-xylose-binding protein" amino acids 28 to 332 (305 residues), 433.6 bits, see alignment E=2.4e-134 PF00532: Peripla_BP_1" amino acids 46 to 239 (194 residues), 35.9 bits, see alignment E=6.1e-13

Best Hits

Swiss-Prot: 44% identical to XYLF_ECOLI: D-xylose-binding periplasmic protein (xylF) from Escherichia coli (strain K12)

KEGG orthology group: K10543, D-xylose transport system substrate-binding protein (inferred from 100% identity to sme:SM_b20902)

MetaCyc: 44% identical to xylose ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-33-RXN [EC: 7.5.2.10, 7.5.2.13]

Predicted SEED Role

"Xylose ABC transporter, periplasmic xylose-binding protein XylF" in subsystem Xylose utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.10 or 7.5.2.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q926F3 at UniProt or InterPro

Protein Sequence (345 amino acids)

>SM_b20902 sugar uptake ABC transporter substrate-binding protein precursor (Sinorhizobium meliloti 1021)
MKSILKLMAGAAIIASMHSAAIAKDLVIGVSWSNFQEERWKTDEAAIKAALEASGDKYIS
ADAQSSAAKQLTDIESLIAQGANALIVLAQDSDAIGPAIEKAAAEGIPVVGYDRLIENPD
AFYITFDNKEVGRLQAREVFKQKPEGNFVFIKGSSADPNADFLFSGQLEVLKEAIDAGKI
KNVGEAYTDGWKPENAQKNMEQFLTANDNKVDAVVASNDGTAGGAIAALDAQGLAGSVPV
SGQDADKAALNRVALGTQTVSVWKDSRELGKKAAEIAVALAGGKTMDEVEGVQTFNGGPK
GVAMKSVFLAPLAITKDNLNVVIDAGWISKEEACQGAKSDVAACK