Protein Info for SM_b20900 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 644 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 45 to 66 (22 residues), see Phobius details amino acids 78 to 97 (20 residues), see Phobius details amino acids 107 to 131 (25 residues), see Phobius details amino acids 145 to 168 (24 residues), see Phobius details PF03707: MHYT" amino acids 1 to 45 (45 residues), 22.5 bits, see alignment 2.3e-08 amino acids 52 to 105 (54 residues), 36 bits, see alignment 1.4e-12 PF13188: PAS_8" amino acids 175 to 228 (54 residues), 21.1 bits, see alignment 5.8e-08 PF13426: PAS_9" amino acids 184 to 277 (94 residues), 30.8 bits, see alignment E=7.6e-11 TIGR00229: PAS domain S-box protein" amino acids 185 to 285 (101 residues), 41.4 bits, see alignment E=1.4e-14 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 286 to 446 (161 residues), 138.5 bits, see alignment E=1.8e-44 PF00990: GGDEF" amino acids 290 to 445 (156 residues), 148 bits, see alignment E=5.4e-47 PF00563: EAL" amino acids 467 to 521 (55 residues), 50.9 bits, see alignment 3.6e-17 amino acids 524 to 623 (100 residues), 100.3 bits, see alignment E=2.9e-32

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SM_b20900)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92UD8 at UniProt or InterPro

Protein Sequence (644 amino acids)

>SM_b20900 hypothetical protein (Sinorhizobium meliloti 1021)
MLAYDGGIPIAYGVGGTSFSIAVAIAASWVAFSVGLAGTSRHAPAVGGLLLGLGIAAMHV
SGMRAIEVQGRVAFDPETSFAAVLLGTLIAGLALHSFQVLRGVRGLAASILLLVAAICVL
HFTSMSGVVLIPDLSVAATHVFDPFWLAGGVIAASTTLILMAFGALFVDRHLTDLKGLAN
ASLEGMVILRRGEVIEVNERFATLSGRKPAELVGRQRRELFAEAPERRSSNDLGAGEGAS
EGELLHADGGYVPVERLCRTIEYKGRPCDVIFVRDLTARKDAERTIEHLAHHDALTDLSN
RSSFDRRLRQALAAAVHHDDALAVLCLDLDRFKAVNDIFGHGEGDRILRKVADILRAGAG
EADTIARLGGDEFAIVQTGAAQPEAARLLADRILKLFSEEMDTRRDPMAVGVSIGVAICP
GDGTTAERLYGNADTALYRAKQTGKGIACFFDAEMDAAVRTRRQIENDLRHAVVRRQLFL
EYQPLVDVRDDRIVGYEALLRWRHPDRGLVGPNLFIPIGDDVLATLVRLRLLGVRIVMDD
FGTGHSSLSNLQTFPFDKLKIDCSFTASLDKDPAAHAIIRAIIALGHSLNLPVVTEGVET
ERQRQIIVDEGCRQIQGFLTGRPGLAPSVDAASSSSTMPHRVGA