Protein Info for SM_b20893 in Sinorhizobium meliloti 1021

Annotation: sugar uptake ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 transmembrane" amino acids 25 to 47 (23 residues), see Phobius details amino acids 55 to 75 (21 residues), see Phobius details amino acids 80 to 98 (19 residues), see Phobius details amino acids 105 to 126 (22 residues), see Phobius details amino acids 131 to 152 (22 residues), see Phobius details amino acids 164 to 180 (17 residues), see Phobius details amino acids 186 to 207 (22 residues), see Phobius details amino acids 223 to 244 (22 residues), see Phobius details amino acids 250 to 267 (18 residues), see Phobius details amino acids 297 to 318 (22 residues), see Phobius details amino acids 329 to 348 (20 residues), see Phobius details amino acids 353 to 375 (23 residues), see Phobius details amino acids 381 to 398 (18 residues), see Phobius details PF02653: BPD_transp_2" amino acids 51 to 197 (147 residues), 44.7 bits, see alignment E=4.8e-16 amino acids 190 to 392 (203 residues), 99.3 bits, see alignment E=1.1e-32

Best Hits

KEGG orthology group: K10547, putative multiple sugar transport system permease protein (inferred from 100% identity to sme:SM_b20893)

Predicted SEED Role

"Sugar ABC transporter permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92UE4 at UniProt or InterPro

Protein Sequence (404 amino acids)

>SM_b20893 sugar uptake ABC transporter permease (Sinorhizobium meliloti 1021)
MVADTSTETTKPSIGDYLRNNIREYGLLVALVIIMLFFQFVTNGVLFRPVNITNLVLQNS
FIVIMALGMLLIIVAGHIDLSVGSIVAFIGAISAIMLVKWGLPAFVVIPACLIVGGIMGA
AQGYWVAYQKIPSFIVTLAGMLVFRGMTYVVLGGRPIGPFPKDFQILSTGFVPDFLYFLS
PSPETIKNMVALVAVLLLVGYAIFAGVRNRRINEQHGTENEPFVFFAIQMAVISLVALFL
GFQLSTYRGLPNVLVVMGVLIAVYTFVTTRSTIGRRIYAMGGNEKATKLSGINTERLTFY
AFVNMGALAALAGMIITARLNSATPKAGVGFELDVIAACFIGGASASGGVGKITGAVIGA
FIMGVMNNGMSIMGIGIDYQQLIKGLVLLAAVFFDVYNKNKGKG